| Primary information |
|---|
| ID | 12316 |
| Uniprot ID | Q6VU70 |
| Description | Apolipophorin-3 (Apolipophorin-III) (ApoLp-III) |
| Organism | Hyphantria cunea |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Noctuoidea; Erebidae; Arctiinae (tiger moths); Spilosomini; Hyphantria; Hyphantria cunea (Fall webworm moth) (Phalaena cunea) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect apolipophorin-3 family. |
| Tissue Specificity | Hemolymph. |
| Post Translational Modification | NA |
| Function | Assists in the loading of diacylglycerol; generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone; into lipophorin; the hemolymph lipoprotein. It increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It thus plays a critical role in the transport of lipids during flight in several species of insects. |
| Length | 187 |
| Molecular Weight | 20 |
| Name | Apolipophorin-3 |
| Sequence | APLANFLQDLEKRAADIQKTFSEQFQAISNSKNVQDVNKAVKESSDVVLKQLSTLSSSLQSALTDANGKAKEALEQTRQNLEKTAEELRRAHPDVEKQANQLRDKLQAAVQSTLQETQKLAKEVAANMEQTNEKLAPKIKEAFEDFVKQAEAVQKKVHDAATKQ |
| Sequence map | 26-07 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|