Primary information |
---|
ID | 12310 |
Uniprot ID | P02764 |
Description | Alpha-1-acid glycoprotein (Orosomucoid) (OMD) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the calycin superfamily. Lipocalin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Appears to function in modulating the activity of the immune system during the acute-phase reaction. |
Length | 205 |
Molecular Weight | 23 |
Name | Alpha-1-acid glycoprotein |
Sequence | NPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
Sequence map | 22-25 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | Contains a beta-barrel that binds various ligands |
Pharmaceutical Use | NA
|