| Primary information |
|---|
| ID | 12310 |
| Uniprot ID | P02764 |
| Description | Alpha-1-acid glycoprotein (Orosomucoid) (OMD) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Appears to function in modulating the activity of the immune system during the acute-phase reaction. |
| Length | 205 |
| Molecular Weight | 23 |
| Name | Alpha-1-acid glycoprotein |
| Sequence | NPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
| Sequence map | 22-25 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Contains a beta-barrel that binds various ligands |
| Pharmaceutical Use | NA
|