Primary information |
---|
ID | 12308 |
Uniprot ID | P07758 |
Description | Alpha-1-antitrypsin 1-1 (AAT) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (Serine protease inhibitor 1-1) (Serine protease inhibitor A1a) (Serpin A1a) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the serpin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Inhibitor of serine proteases. Its primary target is elastase; but it also has a moderate affinity for plasmin and thrombin. |
Length | 413 |
Molecular Weight | 46 |
Name | Alpha-1-antitrypsin 1-1 |
Sequence | DVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK |
Sequence map | 31-53 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The reactive center loop (RCL) extends out from th |
Pharmaceutical Use | NA
|