| Primary information |
|---|
| ID | 12308 |
| Uniprot ID | P07758 |
| Description | Alpha-1-antitrypsin 1-1 (AAT) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (Serine protease inhibitor 1-1) (Serine protease inhibitor A1a) (Serpin A1a) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the serpin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Inhibitor of serine proteases. Its primary target is elastase; but it also has a moderate affinity for plasmin and thrombin. |
| Length | 413 |
| Molecular Weight | 46 |
| Name | Alpha-1-antitrypsin 1-1 |
| Sequence | DVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK |
| Sequence map | 31-53 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The reactive center loop (RCL) extends out from th |
| Pharmaceutical Use | NA
|