| Primary information |
|---|
| ID | 12302 |
| Uniprot ID | P27731 |
| Description | Transthyretin (Prealbumin) (TBPA) |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in serum (at protein level). Detected in liver and choroid plexus. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Length | 150 |
| Molecular Weight | 16 |
| Name | Transthyretin |
| Sequence | PLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE |
| Sequence map | 23-30 |
| PDB ID | 1TFP; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|