Primary information |
---|
ID | 12301 |
Uniprot ID | P79121 |
Description | Metalloproteinase inhibitor 3 (Tissue inhibitor of metalloproteinases 3) (TIMP-3) |
Organism | Bos taurus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
Subcellular Location | Secreted; extracellular space; extracellular matrix. |
Developmental Stage | NA |
Similarity | Belongs to the protease inhibitor I35 (TIMP) family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. |
Length | 211 |
Molecular Weight | 24 |
Name | Metalloproteinase inhibitor 3 |
Sequence | TCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
Sequence map | 27-31 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|