| Primary information |
|---|
| ID | 12295 |
| Uniprot ID | P42705 |
| Description | Thrombopoietin (C-MPL ligand) (ML) (Megakaryocyte colony-stimulating factor) (Megakaryocyte growth and development factor) (MGDF) |
| Organism | Canis lupus familiaris |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Carnivora; Caniformia; Canidae (dog; coyote; wolf; fox); Canis; Canis lupus (Gray wolf); Canis lupus familiaris (Dog) (Canis familiaris) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the EPO/TPO family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
| Length | 352 |
| Molecular Weight | 37 |
| Name | Thrombopoietin |
| Sequence | PPACDPRLLNKMLRDSHVLHSRLSQCPDIYPLSTPVLLPAVDFSLGEWKTQKEQTKAQDVWGAVALLLDGVLAARGQLGPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTTHKDPNAIFLSFQQLLRGKVRFLLLVAGPTLCAKQSQPTTAVPTNTSLFLTLRKLPNRTSGLLETNSSISARTTGSGLLKRLQGFRAKIPGLLNQTSRSLNQTPGHLSRTHGPLNGTHGLLPGLSLTALGAPDIPPGTSDMDALPPNLWPRYSPSPIHPPPGQYTLFSPLPTSPTPQNPLQPPPPDPSATANSTSPLLIAAHPHFQNLSQEE |
| Sequence map | 29-52 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Two-domain structure with an erythropoietin-like N |
| Pharmaceutical Use | NA
|