| Primary information |
|---|
| ID | 12294 |
| Uniprot ID | P13438 |
| Description | Trophoblast-specific protein alpha |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted; extracellular space |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | It may be a growth factor/hormone; perhaps involved in interaction between the maternal and fetal systems in maintenance of pregnancy. |
| Length | 124 |
| Molecular Weight | 13 |
| Name | Trophoblast-specific protein alpha |
| Sequence | VPEAQLDAELQEQKDKEVLIKAVWSKFMKTNKLHSSENDQETEGSNIEMSASGQLTDEELMKIMTTVLHPMFEEEENKPQPVVDDPEFEDYTESGDGFFVPNQPQ |
| Sequence map | 21-04 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|