| Primary information |
|---|
| ID | 12292 |
| Uniprot ID | Q96PL1 |
| Description | Secretoglobin family 3A member 2 (Pneumo secretory protein 1) (PnSP-1) (Uteroglobin-related protein 1) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in fetal lung. |
| Similarity | Belongs to the secretoglobin family. UGRP subfamily. |
| Tissue Specificity | Highly expressed in lung and trachea (PubMed-12406855; PubMed-12175512; PubMed-12847263). Detected throughout the airway epithelium in lung; with slightly higher expression in large airways (PubMed-12 |
| Post Translational Modification | NA |
| Function | Secreted cytokine-like protein |
| Length | 93 |
| Molecular Weight | 10 |
| Name | Secretoglobin family 3A member 2 |
| Sequence | LINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV |
| Sequence map | 23-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9UEW3 |
| Domain | NA |
| Pharmaceutical Use | NA
|