| Primary information |
|---|
| ID | 12290 |
| Uniprot ID | P0DUJ3 |
| Description | NU-buthitoxin-Ptr1a (N-BUTX-Ptr1a) (NU-BUTX-Ptr1a) |
| Organism | Parabuthus transvaalicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Scorpiones; Buthida; Buthoidea; Buthidae; Parabuthus (burrowing thick-tailed scorpions); Parabuthus transvaalicus (South African fattail scorpion) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Toxin that acts as an agonist on melanocortin receptors (MC1R; MC3R; MC5R; MC5R). After binding to MC1R; the peptide activates the hMC1R/Gs pathway; but after binding to MC4R; it is not able to activate or antagonize the MC4R/Gs pathway. Inhibits melanocyte stimulating hormone (MSH)-binding to human receptors (Ki=2.9 uM to MC1R; Ki=3.9 uM to MC3R; Ki=2.6 uM to MC4R; Ki=2.2 uM to MC5R). This toxin is structurally unrelated to the natural agonists. |
| Length | 34 |
| Molecular Weight | 3 |
| Name | NU-buthitoxin-Ptr1a |
| Sequence | MDMRCSASVECKQKCLKAIGSIFGKCMNKKCKC |
| Sequence map | 1-34 |
| PDB ID | 6SAB; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Has the structural arrangement of an alpha-helix c |
| Pharmaceutical Use | NA
|