Primary information |
---|
ID | 12288 |
Uniprot ID | P09486 |
Description | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted acidic and rich in cysteine) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted; extracellular space; extracellular matrix; basement membrane |
Developmental Stage | Expressed at high levels in tissues undergoing morphogenesis; remodeling and wound repair. |
Similarity | Belongs to the SPARC family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper; several types of collagen; albumin; thrombospondin; PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
Length | 303 |
Molecular Weight | 34 |
Name | SPARC |
Sequence | PQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
Sequence map | 23-03 |
PDB ID | 1BMO; 1NUB; 1SRA; 2V53; |
Drugpedia | DB11093;DB11348;DB14481; |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|