| Primary information |
|---|
| ID | 12286 |
| Uniprot ID | O42146 |
| Description | Metalloproteinase inhibitor 2 (Tissue inhibitor of metalloproteinases 2) (TIMP-2) |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the protease inhibitor I35 (TIMP) family. |
| Tissue Specificity | NA |
| Post Translational Modification | The activity of TIMP2 is dependent on the presence of disulfide bonds. |
| Function | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. |
| Length | 220 |
| Molecular Weight | 24 |
| Name | Metalloproteinase inhibitor 2 |
| Sequence | SCSPIHPQQAFCNADVVIRAKRVSAKEVDSGNDIYGNPIKRIQYEVKQIKMFKGPDQDIEFIYTAPSTEVCGQPLDTGGKKEYLIAGKSEGDGKMHITLCDLVATWDSVSPTQKKSLNQRYQMGCECKISRCLSIPCFVSSSDECLWTDWAMEKIVGGRQAKHYACIKRSDGSCAWYRGMAPPKQEFLDIEDP |
| Sequence map | 30-40 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|