Primary information |
---|
ID | 12281 |
Uniprot ID | O46654 |
Description | Transthyretin (Prealbumin) |
Organism | Sorex araneus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Eulipotyphla (hedgehogs; shrews; moles and others); Soricidae (shrews); Soricinae (red-toothed shrews); Sorex; Sorex araneus (Eurasian common shrew) (European shrew) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the transthyretin family. |
Tissue Specificity | Detected in serum (at protein level). Detected in liver. |
Post Translational Modification | NA |
Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
Length | 147 |
Molecular Weight | 15 |
Name | Transthyretin |
Sequence | PTGTGQSKCPLMVKVLDAVQGSPAVNVAVRVFKKAADETWEPFASGKTSEFGELHGLTTDEKFVEGIIKVELDTKTYWKALGISPFHEYVEVVFHANDSGKRRYTIAALLSPYSYSTTALVSDPKE |
Sequence map | 23-27 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|