| Primary information |
|---|
| ID | 12281 |
| Uniprot ID | O46654 |
| Description | Transthyretin (Prealbumin) |
| Organism | Sorex araneus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Eulipotyphla (hedgehogs; shrews; moles and others); Soricidae (shrews); Soricinae (red-toothed shrews); Sorex; Sorex araneus (Eurasian common shrew) (European shrew) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in serum (at protein level). Detected in liver. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Length | 147 |
| Molecular Weight | 15 |
| Name | Transthyretin |
| Sequence | PTGTGQSKCPLMVKVLDAVQGSPAVNVAVRVFKKAADETWEPFASGKTSEFGELHGLTTDEKFVEGIIKVELDTKTYWKALGISPFHEYVEVVFHANDSGKRRYTIAALLSPYSYSTTALVSDPKE |
| Sequence map | 23-27 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|