| Primary information |
|---|
| ID | 12267 |
| Uniprot ID | Q5NVS2 |
| Description | Transthyretin (Prealbumin) |
| Organism | Pongo abelii |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Ponginae; Pongo; Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in liver. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Length | 147 |
| Molecular Weight | 15 |
| Name | Transthyretin |
| Sequence | PTGAGESKCPLMVKVLDAVRGSPAVNVAVNVFKRAADETWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFAANDSGPRRYTIAALLSPYSYSTTAVVTNPKE |
| Sequence map | 23-27 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|