| Primary information |
|---|
| ID | 12265 |
| Uniprot ID | A4QNN7 |
| Description | Transthyretin (Prealbumin) |
| Organism | Xenopus tropicalis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana; Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
| Length | 151 |
| Molecular Weight | 16 |
| Name | Transthyretin |
| Sequence | PGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL |
| Sequence map | 22-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The N-terminus strongly influences thyroid hormone |
| Pharmaceutical Use | NA
|