Primary information |
---|
ID | 12265 |
Uniprot ID | A4QNN7 |
Description | Transthyretin (Prealbumin) |
Organism | Xenopus tropicalis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana; Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the transthyretin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
Length | 151 |
Molecular Weight | 16 |
Name | Transthyretin |
Sequence | PGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL |
Sequence map | 22-31 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The N-terminus strongly influences thyroid hormone |
Pharmaceutical Use | NA
|