| Primary information |
|---|
| ID | 12260 |
| Uniprot ID | P81556 |
| Description | Metalloproteinase inhibitor 4 (Tissue inhibitor of metalloproteinases 4) (TIMP-4) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the protease inhibitor I35 (TIMP) family. |
| Tissue Specificity | Expressed in retina; smooth muscle; skin; pancreas; skeletal muscle; heart; brain; lung; kidney and testis. Not found in cartilage; spleen and liver. |
| Post Translational Modification | NA |
| Function | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. |
| Length | 224 |
| Molecular Weight | 25 |
| Name | Metalloproteinase inhibitor 4 |
| Sequence | SCAPAHPQQHVCHSALVIRAKISSEKVVPASEDPADTQKMIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSQKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPDECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIVQP |
| Sequence map | 33-44 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|