Primary information |
---|
ID | 12258 |
Uniprot ID | P49142 |
Description | Transthyretin (Prealbumin) |
Organism | Petaurus breviceps |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Metatheria; Diprotodontia; Petauridae (gliding and striped possums); Petaurus (lesser gliding possums); Petaurus breviceps (Australian sugar glider) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the transthyretin family. |
Tissue Specificity | Detected in plasma (at protein level). Detected in liver. |
Post Translational Modification | NA |
Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
Length | 149 |
Molecular Weight | 16 |
Name | Transthyretin |
Sequence | PVAHGGEDSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEKQTWELFASGKTNDNGEIHELTSDDKFGEGLYKVEFDTISYWKALGVSPFHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE |
Sequence map | 23-29 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|