| Primary information |
|---|
| ID | 12254 |
| Uniprot ID | P35577 |
| Description | Thyroxine-binding globulin (Serpin A7) (T4-binding globulin) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the serpin family. |
| Tissue Specificity | Expressed by the liver and secreted in plasma. |
| Post Translational Modification | NA |
| Function | Major thyroid hormone transport protein in serum. |
| Length | 418 |
| Molecular Weight | 46 |
| Name | Thyroxine-binding globulin |
| Sequence | PHNSSEGKVTTCHLPQQNATLYKMPSINADFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKELQQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEINSYVEKQTKGKIVGLIQDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLEQYYHYVDVELNCTVLQMDYSANALALFVLPKEGHMEWVEAAMSSKTLKKWNHLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITKDNGLKLSYAFHKAVLHIGEEGTKEGASPEAGSLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDPTKE |
| Sequence map | 27-58 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|