| Primary information |
|---|
| ID | 12237 |
| Uniprot ID | B6DD23 |
| Description | U13-lycotoxin-Ls1d (Toxin-like structure LSTX-L5) |
| Organism | Lycosa singoriensis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Araneae (spiders); Araneomorphae; Entelegynae; RTA clade; Lycosoidea; Lycosidae (wolf spiders); Lycosa; Lycosa singoriensis (Wolf spider) (Aranea singoriensis) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the neurotoxin 05 (agouti) family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | Contains 6 disulfide bonds. |
| Function | NA |
| Length | 120 |
| Molecular Weight | 13 |
| Name | U13-lycotoxin-Ls1d |
| Sequence | CADMGQDCKDDCDCCLNIATCNCRFGRYFCSCTFGDYQTCLRKKGKCKRNRPQSCPRSNLNRKKG |
| Sequence map | 57 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The presence of a 'disulfide through disulfide kOR |
| Pharmaceutical Use | NA
|