| Primary information |
|---|
| ID | 12233 |
| Uniprot ID | Q9MYN8 |
| Description | Transthyretin (Prealbumin) |
| Organism | Erinaceus europaeus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Eulipotyphla (hedgehogs; shrews; moles and others); Erinaceidae (hedgehogs); Erinaceinae (spiny hedgehogs); Erinaceus; Erinaceus europaeus (Western European hedgehog) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Length | 145 |
| Molecular Weight | 15 |
| Name | Transthyretin |
| Sequence | PTGQSKCPLMVKVLDAVRGSPAVNVAVKVFKKAADETWEPFASGKTSESGELHGLTTDEKFVEGVYKVELDTKSYWKTLGISPFHEYVEVVFTANDSGQRRYTIAALLSPYSYSTTALVSDPKE |
| Sequence map | 23-25 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|