| Primary information |
|---|
| ID | 12230 |
| Uniprot ID | P31779 |
| Description | Transthyretin (Prealbumin) (THBP) (Tadpole T3-binding protein) (T-T3BP) |
| Organism | Lithobates catesbeianus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae (riparian frogs); Lithobates; Lithobates catesbeianus (American bullfrog) (Rana catesbeiana) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in tadpoles from premetamorphic stage X; increasing until the end of prometamorphic stage (stage XX). Expression then declines during metamorphic climax stages (stages XXI-XXV); becoming und |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in plasma (at protein level). Expressed during metamorphosis in tadpole liver but not in tadpole brain; nor adult liver. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
| Length | 153 |
| Molecular Weight | 16 |
| Name | Transthyretin |
| Sequence | HGEADSKCPLMVKVLDAVRGIPAAKLPVKVFKQNEDKSWDLISSGTTSSDGEIHNLATEEQFVEGIYKLEFATKRFWSKLGLTPFHEYVDVVFTANDAGHRHYTTAVLLTPYSFSTTAVVSDVKEAHV |
| Sequence map | 27-33 |
| PDB ID | 1LJB; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The N-terminus strongly influences thyroid hormone |
| Pharmaceutical Use | NA
|