| Primary information |
|---|
| ID | 12225 |
| Uniprot ID | O55245 |
| Description | Transthyretin (crocTTR) (Prealbumin) |
| Organism | Crocodylus porosus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Crocodylia (alligators and others); Longirostres; Crocodylidae (crocodilians); Crocodylus; Crocodylus porosus (Saltwater crocodile) (Estuarine crocodile) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Strongly expressed in the brain; and to a lesser extent in the eye. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
| Length | 150 |
| Molecular Weight | 16 |
| Name | Transthyretin |
| Sequence | PLVSHGSIDSKCPLMVKVLDAVRGSPAANVAIKVFKKTSDGDWQEFAAGKTTEFGEVHELTSDEKFVEGIYRVEFDTSSYWKALGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE |
| Sequence map | 23-30 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The N-terminus strongly influences thyroid hormone |
| Pharmaceutical Use | NA
|