| Primary information |
|---|
| ID | 12219 |
| Uniprot ID | P08427 |
| Description | Pulmonary surfactant-associated protein A (PSAP) (PSP-A) (SP-A) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix. Secreted; extracellular space; surface film. |
| Developmental Stage | NA |
| Similarity | Belongs to the SFTPA family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | In presence of calcium ions; it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages. |
| Length | 248 |
| Molecular Weight | 26 |
| Name | Pulmonary surfactant-associated protein A |
| Sequence | VTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF |
| Sequence map | 25-08 |
| PDB ID | 1GIE; 1R13; 1R14; 3PAK; 3PAQ; 3PAR; 3PBF; 4WR9; 4WRC; 4WRE; 4WRF; 4WUW; 4WUX; 5FFR; 5FFS; 5FFT; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|