| Primary information |
|---|
| ID | 12218 |
| Uniprot ID | O35257 |
| Description | Prolactin-6A1 (Placental prolactin-like protein B) (PLP-B) (PRL-like protein B) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | Increased gradually from days 8-12 and decrease to low levels by days 16. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expressed in both placenta and decidual tissues. Detected first in deciduals cells early in gestation and in trophoblasts later in pregnancy. |
| Post Translational Modification | NA |
| Function | NA |
| Length | 230 |
| Molecular Weight | 26 |
| Name | Prolactin-6A1 |
| Sequence | PMYASLDEYGEMSIYDLLDHVTILSHNVSELTAEMHRIFMEDVRYKPGRWFSDRYLTACHTSTLTISVSKEGARQMPGVFLVKEMISMLTAWRYPLYHIITELSYMEQAPDEIISRARNIEEKIIVLIEALRGILSKIQPGPPENERYPVWNELASLQSPDEDLRHLTLFNLFQCLVKDSRKIDSSIRLLKCKLLYNRDC |
| Sequence map | 33-50 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q08501 |
| Domain | NA |
| Pharmaceutical Use | NA
|