| Primary information |
|---|
| ID | 12214 |
| Uniprot ID | Q99P67 |
| Description | Sclerostin |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sclerostin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
| Length | 213 |
| Molecular Weight | 23 |
| Name | Sclerostin |
| Sequence | KNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY |
| Sequence map | 32-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|