Primary information |
---|
ID | 12213 |
Uniprot ID | Q99P68 |
Description | Sclerostin |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted; extracellular space; extracellular matrix |
Developmental Stage | NA |
Similarity | Belongs to the sclerostin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
Length | 211 |
Molecular Weight | 23 |
Name | Sclerostin |
Sequence | GWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY |
Sequence map | 27-31 |
PDB ID | 2KD3; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|