| Primary information |
|---|
| ID | 12206 |
| Uniprot ID | B7ZS96 |
| Description | Transthyretin (xTTR) (Prealbumin) |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in tadpoles from premetamorphic stage 53 until the end of prometamorphic stage 60. Expression levels reach a maximum at prometamorphic stages 58 to 59; then decline gradually during metamorp |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in plasma (at protein level). Expressed during metamorphosis in tadpole liver; but not in tadpole brain nor adult liver. Between 1.5 and 3 days of development; also expressed in the mesoderm |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
| Length | 153 |
| Molecular Weight | 16 |
| Name | Transthyretin |
| Sequence | PPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL |
| Sequence map | 22-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The N-terminus strongly influences thyroid hormone |
| Pharmaceutical Use | NA
|