Primary information |
---|
ID | 12206 |
Uniprot ID | B7ZS96 |
Description | Transthyretin (xTTR) (Prealbumin) |
Organism | Xenopus laevis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
Subcellular Location | Secreted |
Developmental Stage | Expressed in tadpoles from premetamorphic stage 53 until the end of prometamorphic stage 60. Expression levels reach a maximum at prometamorphic stages 58 to 59; then decline gradually during metamorp |
Similarity | Belongs to the transthyretin family. |
Tissue Specificity | Detected in plasma (at protein level). Expressed during metamorphosis in tadpole liver; but not in tadpole brain nor adult liver. Between 1.5 and 3 days of development; also expressed in the mesoderm |
Post Translational Modification | NA |
Function | Thyroid hormone-binding protein; with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain. |
Length | 153 |
Molecular Weight | 16 |
Name | Transthyretin |
Sequence | PPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL |
Sequence map | 22-33 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The N-terminus strongly influences thyroid hormone |
Pharmaceutical Use | NA
|