| Primary information |
|---|
| ID | 12204 |
| Uniprot ID | P02767 |
| Description | Transthyretin (Prealbumin) (TBPA) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the transthyretin family. |
| Tissue Specificity | Detected in serum and cerebrospinal fluid (at protein level). Highly expressed in the choroid plexus. Detected at lower levels in the liver. |
| Post Translational Modification | NA |
| Function | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Length | 147 |
| Molecular Weight | 15 |
| Name | Transthyretin |
| Sequence | PGGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Sequence map | 23-27 |
| PDB ID | 1GKE; 1IE4; 1KGI; 1KGJ; 1RVS; 2M5K; 2M5M; 3ZPK; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|