| Primary information |
|---|
| ID | 12197 |
| Uniprot ID | P52823 |
| Description | Stanniocalcin-1 (STC-1) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the stanniocalcin family. |
| Tissue Specificity | Expressed in most tissues; with the highest levels in ovary; prostate; heart; kidney and thyroid. In the kidney; expression is confined to the nephron; specifically in the distal convoluted tubule and |
| Post Translational Modification | NA |
| Function | Stimulates renal phosphate reabsorption; and could therefore prevent hypercalcemia. |
| Length | 247 |
| Molecular Weight | 27 |
| Name | Stanniocalcin-1 |
| Sequence | AAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Sequence map | 38-07 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|