| Primary information |
|---|
| ID | 12193 |
| Uniprot ID | G3V686 |
| Description | Resistin-like gamma (Resistin-like molecule gamma) (RELMgamma) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the resistin/FIZZ family. |
| Tissue Specificity | Highly expressed in bone marrow; spleen and white blood cells. Also detected at low levels in thymus; lung; trachea; white adipose tissue; nasal respiratory epithelium; colon; small intestine; kidney; |
| Post Translational Modification | NA |
| Function | Probable hormone (Probable). Promotes chemotaxis in myeloid cells. |
| Length | 111 |
| Molecular Weight | 11 |
| Name | Resistin-like gamma |
| Sequence | GTLESIVEQKVKELLAHRDNCPSTVTKTLSCTSVKATGRLASCPPGMAVTGCACGYACGSWDIRDGTTCHCQCAVMDWATARCCQLS |
| Sequence map | 25-51 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|