| Primary information |
|---|
| ID | 12182 |
| Uniprot ID | Q99P86 |
| Description | Resistin-like beta (Cysteine-rich secreted protein A12-beta) (Cysteine-rich secreted protein FIZZ2) (RELMbeta) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the resistin/FIZZ family. |
| Tissue Specificity | Strongly expressed in colon; and at lower levels in ileum (PubMed-15834545). In colon; found throughout the crypt and surface epithelium and in goblet cells (at protein level) (PubMed-15834545). Speci |
| Post Translational Modification | NA |
| Function | Probable hormone. |
| Length | 105 |
| Molecular Weight | 11 |
| Name | Resistin-like beta (Cysteine-rich secreted protein A12-beta) (Cysteine-rich secreted protein FIZZ2) |
| Sequence | QCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA |
| Sequence map | 82 |
| PDB ID | 1RH7; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|