| Primary information |
|---|
| ID | 12181 |
| Uniprot ID | Q9BQ08 |
| Description | Resistin-like beta (Colon and small intestine-specific cysteine-rich protein) (Colon carcinoma-related gene protein) (Cysteine-rich secreted protein A12-alpha-like 1) (Cysteine-rich secreted protein FIZZ2) (RELMbeta) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the resistin/FIZZ family. |
| Tissue Specificity | Expressed only in the gastrointestinal tract; particularly the colon. |
| Post Translational Modification | NA |
| Function | Probable hormone. |
| Length | 111 |
| Molecular Weight | 11 |
| Name | Resistin-like beta (Colon and small intestine-specific cysteine-rich protein) (Colon carcinoma-relat |
| Sequence | QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
| Sequence map | 88 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|