| Primary information |
|---|
| ID | 12179 |
| Uniprot ID | Q9EP95 |
| Description | Resistin-like alpha (Cysteine-rich secreted protein A12-gamma) (Cysteine-rich secreted protein FIZZ1) (Hypoxia-induced mitogenic factor) (Parasite-induced macrophage novel gene 1 protein) (RELMalpha) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the resistin/FIZZ family. |
| Tissue Specificity | Highest levels in adipose tissue. |
| Post Translational Modification | NA |
| Function | Probable hormone. Plays a role in pulmonary vascular remodeling. |
| Length | 111 |
| Molecular Weight | 11 |
| Name | Resistin-like alpha (Cysteine-rich secreted protein A12-gamma) (Cysteine-rich secreted protein FIZZ1 |
| Sequence | DETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
| Sequence map | 88 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|