Primary information |
---|
ID | 12179 |
Uniprot ID | Q9EP95 |
Description | Resistin-like alpha (Cysteine-rich secreted protein A12-gamma) (Cysteine-rich secreted protein FIZZ1) (Hypoxia-induced mitogenic factor) (Parasite-induced macrophage novel gene 1 protein) (RELMalpha) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the resistin/FIZZ family. |
Tissue Specificity | Highest levels in adipose tissue. |
Post Translational Modification | NA |
Function | Probable hormone. Plays a role in pulmonary vascular remodeling. |
Length | 111 |
Molecular Weight | 11 |
Name | Resistin-like alpha (Cysteine-rich secreted protein A12-gamma) (Cysteine-rich secreted protein FIZZ1 |
Sequence | DETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
Sequence map | 88 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|