Primary information |
---|
ID | 12178 |
Uniprot ID | Q9HD89 |
Description | Resistin (Adipose tissue-specific secretory factor) (ADSF) (C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein) (Cysteine-rich secreted protein A12-alpha-like 2) (Cysteine-rich secreted protein FIZZ3) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the resistin/FIZZ family. |
Tissue Specificity | Expressed in white adipose tissue (at protein level) (PubMed-11201732). Widely expressed; with particularly strong expression in lung; bone marrow; breast and peripheral blood (PubMed-15248836). Expre |
Post Translational Modification | NA |
Function | Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Promotes chemotaxis in myeloid cells |
Length | 108 |
Molecular Weight | 11 |
Name | Resistin (Adipose tissue-specific secretory factor) (ADSF) (C/EBP-epsilon-regulated myeloid-specific |
Sequence | KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Sequence map | 90 |
PDB ID | 1LV6; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|