| Primary information |
|---|
| ID | 12141 |
| Uniprot ID | Q945T0 |
| Description | Rapid alkalinization factor (NtRALF) |
| Organism | Nicotiana tabacum |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana; Nicotiana tabacum (Common tobacco) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the plant rapid alkalinization factor (RALF) family. |
| Tissue Specificity | NA |
| Post Translational Modification | Proteolytically cleaved; probably by S1P; a subtilisin-like serine protease (subtilase). |
| Function | Cell signaling peptide that may regulate plant stress; growth; and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases. Prevents root growth and seedling development in heterologous system. |
| Length | 115 |
| Molecular Weight | 12 |
| Name | Rapid alkalinization factor (NtRALF) |
| Sequence | ATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCSAITRCRS |
| Sequence map | 49 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|