| Primary information |
|---|
| ID | 12137 |
| Uniprot ID | P17085 |
| Description | Insulin-like growth factor I (IGF-I) (Somatomedin) |
| Organism | Oncorhynchus kisutch |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Protacanthopterygii; Salmoniformes (salmons and trouts); Salmonidae (salmonids); Salmoninae (trouts; salmons & chars); Oncorhynchus; Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | All the isoforms are expressed in embryos; juvenile and adult liver; muscle and brain. At least one isoform is expressed in heart; kidney; testes; ovary; adipose tissue and spleen of juvenile salmon. |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R; leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. |
| Length | 188 |
| Molecular Weight | 20 |
| Name | Insulin-like growth factor I (IGF-I) (Somatomedin) |
| Sequence | GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA |
| Sequence map | 70 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|