| Primary information |
|---|
| ID | 12136 |
| Uniprot ID | P05017 |
| Description | Insulin-like growth factor I (IGF-I) (Somatomedin) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin; not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb |
| Length | 153 |
| Molecular Weight | 17 |
| Name | Insulin-like growth factor I (IGF-I) (Somatomedin) |
| Sequence | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
| Sequence map | 70 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q60751 |
| Domain | NA |
| Pharmaceutical Use | NA
|