Primary information |
---|
ID | 12109 |
Uniprot ID | Q99P87 |
Description | Resistin (Adipose tissue-specific secretory factor) (ADSF) (Adipose-specific cysteine-rich secreted protein A12-alpha) (Cysteine-rich secreted protein FIZZ3) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the resistin/FIZZ family. |
Tissue Specificity | Expressed in white but not brown adipose tissue in a variety of organs. |
Post Translational Modification | NA |
Function | Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. |
Length | 114 |
Molecular Weight | 12 |
Name | Resistin (Adipose tissue-specific secretory factor) (ADSF) (Adipose-specific cysteine-rich secreted |
Sequence | SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
Sequence map | 94 |
PDB ID | 1RFX; 1RGX; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|