| Primary information |
|---|
| ID | 12109 |
| Uniprot ID | Q99P87 |
| Description | Resistin (Adipose tissue-specific secretory factor) (ADSF) (Adipose-specific cysteine-rich secreted protein A12-alpha) (Cysteine-rich secreted protein FIZZ3) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the resistin/FIZZ family. |
| Tissue Specificity | Expressed in white but not brown adipose tissue in a variety of organs. |
| Post Translational Modification | NA |
| Function | Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. |
| Length | 114 |
| Molecular Weight | 12 |
| Name | Resistin (Adipose tissue-specific secretory factor) (ADSF) (Adipose-specific cysteine-rich secreted |
| Sequence | SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
| Sequence map | 94 |
| PDB ID | 1RFX; 1RGX; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|