| Primary information |
|---|
| ID | 12108 |
| Uniprot ID | P43511 |
| Description | Pheromone biosynthesis-activating neuropeptide (Lyd-PBAN) (FXPRL-amide) (Pyrokinin) |
| Organism | Lymantria dispar |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Noctuoidea; Erebidae; Lymantriinae (tussock moths); Lymantria (gypsy moths); Lymantria dispar (Gypsy moth) (Porthetria dispar) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the pyrokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in the control of pheromone production in females. |
| Length | 33 |
| Molecular Weight | 3 |
| Name | Pheromone biosynthesis-activating neuropeptide (Lyd-PBAN) (FXPRL-amide) (Pyrokinin) |
| Sequence | LADDMPATMADQEVYRPEPEQIDSRNKYFSPRL |
| Sequence map | 33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|