| Primary information |
|---|
| ID | 12105 |
| Uniprot ID | E2E4L2 |
| Description | Goannatyrotoxin-Vere1 (Venom peptide YY-like) |
| Organism | Varanus eremius |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Paleoanguimorpha (Old World anguimorph lizards); Varanoidea; Varanidae (monitors); Varanus |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Expressed by the mandibular venom gland. |
| Post Translational Modification | NA |
| Function | Shows a potent unique triphasic action; rapid biphasic hypertension followed by prolonged hypotension. |
| Length | 99 |
| Molecular Weight | 11 |
| Name | Goannatyrotoxin-Vere1 (Venom peptide YY-like) |
| Sequence | YPTKPESPGPDATPEELAEYMTKIRQYINLVTRQRY |
| Sequence map | 36 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|