| Primary information |
|---|
| ID | 12104 |
| Uniprot ID | P0CJ11 |
| Description | Venom protein 55.1 |
| Organism | Lychas mucronatus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Scorpiones; Buthida; Buthoidea; Buthidae; Lychas (bark scorpions); Lychas mucronatus (Chinese swimming scorpion) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the diuretic hormone class 2 family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Regulates fluid secretion. |
| Length | 73 |
| Molecular Weight | 7 |
| Name | Venom protein 55.1 |
| Sequence | TTSSMKRELDLGMSRGHSGSQVGKALLGIQSANRTDGP |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|