| Primary information |
|---|
| ID | 12097 |
| Uniprot ID | A8MQ92 |
| Description | Protein RALF-like 2 |
| Organism | Arabidopsis thaliana |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana (Mouse-ear cress) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the plant rapid alkalinization factor (RALF) family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Cell signaling peptide that may regulate plant stress; growth; and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases. |
| Length | 97 |
| Molecular Weight | 11 |
| Name | Protein RALF-like 2 |
| Sequence | QKVIGYPAIGRDGARGCSPKDPSCPQQPEKPYKRGCEKITRCERDRRKQAHLRNPRKVLDVVAVMAKAKQLY |
| Sequence map | 72 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|