Primary information |
---|
ID | 12096 |
Uniprot ID | Q9LH43 |
Description | Protein RALF-like 27 |
Organism | Arabidopsis thaliana |
Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana (Mouse-ear cress) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the plant rapid alkalinization factor (RALF) family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Cell signaling peptide that may regulate plant stress; growth; and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases. |
Length | 117 |
Molecular Weight | 12 |
Name | Protein RALF-like 27 |
Sequence | QQRKYLSYKTLQKQPTCDGRIAGNCIGTVNPKGATCTYYQRCKRAA |
Sequence map | 46 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|