| Primary information |
|---|
| ID | 12088 |
| Uniprot ID | Q03191 |
| Description | Trefoil factor 3 (Intestinal trefoil factor) (rITF) (Polypeptide P1.B) (rP1.B) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in goblet cells of the intestines; and colon; in paraventricular hypothalamus and supraoptic nuclei. Weakly expressed in gastric epithelial cells (at protein level). Expressed by goblet cell |
| Post Translational Modification | NA |
| Function | Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen). |
| Length | 81 |
| Molecular Weight | 8 |
| Name | Trefoil factor 3 (Intestinal trefoil factor) (rITF) (Polypeptide P1.B) (rP1.B) |
| Sequence | QEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF |
| Sequence map | 59 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|