Primary information |
---|
ID | 12088 |
Uniprot ID | Q03191 |
Description | Trefoil factor 3 (Intestinal trefoil factor) (rITF) (Polypeptide P1.B) (rP1.B) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted; extracellular space; extracellular matrix |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Expressed in goblet cells of the intestines; and colon; in paraventricular hypothalamus and supraoptic nuclei. Weakly expressed in gastric epithelial cells (at protein level). Expressed by goblet cell |
Post Translational Modification | NA |
Function | Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen). |
Length | 81 |
Molecular Weight | 8 |
Name | Trefoil factor 3 (Intestinal trefoil factor) (rITF) (Polypeptide P1.B) (rP1.B) |
Sequence | QEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF |
Sequence map | 59 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|