| Primary information |
|---|
| ID | 12075 |
| Uniprot ID | Q02816 |
| Description | Insulin-like growth factor II (IGF-II) (Erythrotropin) |
| Organism | Oncorhynchus mykiss |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Protacanthopterygii; Salmoniformes (salmons and trouts); Salmonidae (salmonids); Salmoninae (trouts; salmons & chars); Oncorhynchus; Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for integrin which is required for IGF2 signaling. |
| Length | 214 |
| Molecular Weight | 24 |
| Name | Insulin-like growth factor II (IGF-II) (Erythrotropin) |
| Sequence | EVASAETLCGGELVDALQFVCEDRGFYFSRPTSRSNSRRSQNRGIVEECCFRSCDLNLLEQYCAKPAKSE |
| Sequence map | 70 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|