Primary information |
---|
ID | 12073 |
Uniprot ID | P33717 |
Description | Insulin-like growth factor II (IGF-II) |
Organism | Gallus gallus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for integrin which is required for IGF2 signaling. |
Length | 187 |
Molecular Weight | 20 |
Name | Insulin-like growth factor II (IGF-II) |
Sequence | AYGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE |
Sequence map | 68 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|