| Primary information |
|---|
| ID | 11997 |
| Uniprot ID | P0CJ22 |
| Description | Neuropeptide Y1-like conopeptide (Cono-NPY1) (NPY1-like conopeptide) |
| Organism | Conus betulinus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Dendroconus; Conus betulinus (Beech cone) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Expressed by the venom duct. |
| Post Translational Modification | NA |
| Function | Causes hyperactivity such as jumping; rapid circling and tail flicking; when intraventricularly injected into mice brain. |
| Length | 37 |
| Molecular Weight | 4 |
| Name | Neuropeptide Y1-like conopeptide (Cono-NPY1) (NPY1-like conopeptide) |
| Sequence | TVSDPPARPAVFHSREELMNYVRELNRYFAIVGRPRF |
| Sequence map | 37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|