| Primary information |
|---|
| ID | 11990 |
| Uniprot ID | Q26491 |
| Description | Ion transport peptide (ITP) |
| Organism | Schistocerca gregaria |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Cyrtacanthacridinae (migratory bird locusts); Schistocerca; Schistocerca gregaria (Desert locust) (Gryllus gregarius) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Brain and corpus cardiacum. |
| Post Translational Modification | NA |
| Function | Stimulates salt and water reabsorption and inhibits acid secretion in the ileum of S.gregaria. |
| Length | 130 |
| Molecular Weight | 15 |
| Name | Ion transport peptide (ITP) |
| Sequence | SFFDIQCKGVYDKSIFARLDRICEDCYNLFREPQLHSLCRSDCFKSPYFKGCLQALLLIDEEEKFNQMVEIL |
| Sequence map | 72 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|