| Primary information |
|---|
| ID | 11984 |
| Uniprot ID | Q8MP00 |
| Description | Neuropeptide F (AeaNPF) (NPF) |
| Organism | Aedes aegypti |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Nematocera; Culicomorpha; Culicoidea; Culicidae (mosquitos); Culicinae; Aedini; Aedes; Stegomyia; Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Expressed in hemolymph; brain and midgut. |
| Post Translational Modification | NA |
| Function | An integral part of the sensory system that mediates food signaling; providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. May have a hormonal role in females. |
| Length | 90 |
| Molecular Weight | 10 |
| Name | Neuropeptide F (AeaNPF) (NPF) |
| Sequence | SFTDARPQDDPTSVAEAIRLLQELETKHAQHARPRF |
| Sequence map | 56 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|