| Primary information |
|---|
| ID | 11959 |
| Uniprot ID | P05019 |
| Description | Insulin-like growth factor I (IGF-I) (Mechano growth factor) (MGF) (Somatomedin-C) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin; not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation |
| Length | 195 |
| Molecular Weight | 21 |
| Name | Insulin-like growth factor I (IGF-I) (Mechano growth factor) (MGF) (Somatomedin-C) |
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Sequence map | 70 |
| PDB ID | 1B9G; 1BQT; 1GF1; 1GZR; 1GZY; 1GZZ; 1H02; 1H59; 1IMX; 1PMX; 1TGR; 1WQJ; 2DSP; 2DSQ; 2DSR; 2GF1; 3GF1 |
| Drugpedia | DB01890;DB02643; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|