| Primary information |
|---|
| ID | 11955 |
| Uniprot ID | Q90WX8 |
| Description | Insulin-like growth factor III (IGF-III) (Insulin-like growth factor 3) (xIGF-3) |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed both maternally and zygotically. Expressed in the dorsal midline during gastrulation and neurulation. Expression is strong in the prospective ventral forebrain region of the anterior neural |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Promotes anterior neural development. |
| Length | 127 |
| Molecular Weight | 14 |
| Name | Insulin-like growth factor III (IGF-III) (Insulin-like growth factor 3) (xIGF-3) |
| Sequence | RCLRPRSKELLCGSELVDILQFICGPTGFYVSKGASFRNRNRPGIVEECCFCGCSVAILESYCAAPVTNFTG |
| Sequence map | 72 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|